CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Huli Huli Chicken

Sweet-savory Hawaiian grilled chicken with a signature caramelized glaze of pineapple, soy, and ginger. Charred outside, juicy inside—ready in 40 minutes.

Total time
40 min
Servings
4
Calories
420
Protein
38g
Huli Huli Chicken
casualsatisfyinghawaiianchickencrispyjuicytenderweeknight

Ingredients

  • ½ cup pineapple juice
  • ⅓ cup soy sauce
  • 1 tbsp ginger, minced
  • 3 cloves garlic, minced
  • 2 tbsp brown sugar
  • 1 tbsp rice vinegar
  • 8 pieces chicken thighs or breasts, bone-in skin-on
  • 2 tbsp olive oil

Instructions

  1. 1

    Combine pineapple juice, soy sauce, ginger, garlic, brown sugar, and vinegar in a small saucepan.

  2. 2

    Bring to a boil, then reduce to low heat and simmer until syrupy, about 8 minutes.

  3. 3

    Remove from heat and let cool slightly. Reserve 3 tbsp for serving.

  4. 4

    Pat chicken dry and season with salt and pepper. Brush with olive oil on all sides.

  5. 5

    Heat a grill or cast iron skillet to medium-high heat until very hot, about 2 minutes.

  6. 6

    Place chicken skin-side down on the grill. Do not move for 5 minutes—skin should be deeply golden.

  7. 7

    Flip chicken. Brush the cooked side generously with glaze, then grill 4 more minutes.

  8. 8

    Flip again, brush the second side with glaze, and grill 3 minutes until internal temperature reaches 165°F.

  9. 9

    Transfer to a platter. Drizzle with reserved glaze and serve immediately.

Tools you’ll need

  • small saucepan
  • grill or 12-inch cast iron skillet
  • meat thermometer
  • brush or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.