Honey Matcha Latte
A creamy, earthy matcha latte sweetened with honey and topped with a silky milk foam. Ready in 5 minutes with just a whisk and warm milk.
- Total time
- 5 min
- Servings
- 1
- Calories
- 145
- Protein
- 4g
quicksimplevegetariancreamysilkyweeknightcozybeverage
Ingredients
- 1 tsp matcha powder
- 2 tbsp hot water
- 1 tbsp honey
- 8 oz milk (whole or 2%)
Instructions
- 1
Heat milk in a small saucepan until steaming, about 2 minutes. Do not boil.
- 2
Pour hot water into a mug. Add matcha powder and whisk vigorously until no lumps remain.
- 3
Whisk honey into the matcha mixture until fully dissolved and smooth.
- 4
Pour hot milk into the mug, holding back foam with a spoon. Top with remaining foam.
- 5
Serve immediately.
Tools you’ll need
- small saucepan
- mug
- whisk or matcha brush
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
