Homemade Cappuccino
Equal parts espresso, steamed milk, and milk foam — the classic Italian café drink. Ready in under 5 minutes with an espresso machine or strong brewed coffee.
- Total time
- 5 min
- Servings
- 1
- Calories
- 135
- Protein
- 8g

cozysimpleitalianvegetariancreamysilkybreakfastbrunch
Ingredients
- 1 double shot (2 oz) espresso
- 4 oz whole milk
- ½ tsp (optional) sugar
Instructions
- 1
Pull a double shot of espresso (about 2 oz) into a cappuccino cup.
- 2
Steam 4 oz of cold whole milk until it reaches 150–155°F and a smooth microfoam forms.
- 3
Pour the steamed milk into the espresso, holding back the foam with a spoon to pour only liquid first.
- 4
Top with a thick layer of milk foam (about 1/4 inch). Add sugar if desired and serve immediately.
Tools you’ll need
- espresso machine with steam wand
- cappuccino cup (5–6 oz ceramic)
- milk pitcher or frothing jug
- spoon
- thermometer (optional)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
More recipes like this
Craving more? Browse all Italian recipes →



