CookSnap is coming soon — Join the waitlist →

Haupia Pudding

Silky Hawaiian coconut pudding made with just coconut milk, sugar, and cornstarch. Light, naturally sweet, and ready in 20 minutes—no eggs or cream needed.

Total time
20 min
Servings
6
Calories
185
Protein
1g
Haupia Pudding
lighttropicalhawaiianvegetariandairy-freesilkysmoothcreamy

Ingredients

  • 2 cans (13.5 oz each) coconut milk
  • ½ cup sugar
  • 5 tablespoons cornstarch
  • ¼ teaspoon salt
  • ½ teaspoon vanilla extract
  • 3 tablespoons water
  • ¼ cup (optional garnish) toasted coconut flakes

Instructions

  1. 1

    Pour both cans of coconut milk into a medium saucepan, then add the sugar and salt; stir with a wooden spoon until the sugar dissolves, about 1 minute.

  2. 2

    In a small bowl, whisk together the cornstarch and 3 tablespoons of cold water until no lumps remain, creating a smooth slurry like thick cream.

  3. 3

    Place the saucepan over medium heat and stir constantly until the coconut mixture is hot and beginning to steam, about 3 minutes.

  4. 4

    Slowly pour the cornstarch slurry into the hot coconut mixture while stirring constantly with a whisk to prevent lumps from forming.

  5. 5

    Continue stirring over medium heat until the mixture thickens and turns glossy, about 2 to 3 minutes—it should coat the back of a spoon without running off immediately.

  6. 6

    Remove the saucepan from the heat, then stir in the vanilla extract until fully mixed in.

  7. 7

    Pour the haupia into a 9-by-13-inch baking dish, smoothing the top with a spatula to create an even surface.

  8. 8

    Let the pudding cool at room temperature for 10 to 15 minutes until it sets to a firm, custard-like texture you can cut with a spoon.

  9. 9

    Cut the haupia into 6 equal squares, then carefully lift each square with a spatula and place on a serving plate.

  10. 10

    Garnish the top of each square with toasted coconut flakes if desired, then serve immediately or refrigerate until ready to eat.

Tools you’ll need

  • medium saucepan
  • wooden spoon
  • small mixing bowl
  • whisk
  • 9-by-13-inch baking dish
  • rubber spatula
  • serving spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.