CookSnap is coming soon — Join the waitlist →
Back to recipes

Grilled Tsipoura with Lemon & Oregano

Whole Mediterranean sea bream, simply seasoned and grilled until skin crisps and flesh turns opaque. A Greek island classic ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
48g
Grilled Tsipoura with Lemon & Oregano
freshsimpleelegantgreekfishcrispytenderjuicy

Ingredients

  • 2 fish, about 1.25 lbs each whole tsipoura (sea bream), cleaned and gutted
  • 3 tbsp olive oil
  • 1 whole, halved lemon
  • 1 tsp dried oregano
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Pat tsipoura dry inside and out with paper towels. Score skin diagonally 3 times on each side.

  2. 2

    Brush fish inside cavity and both sides generously with olive oil.

  3. 3

    Season cavities and both sides with salt, pepper, and oregano. Stuff each cavity with lemon half.

  4. 4

    Preheat grill to medium-high. Oil the grates with a folded oiled paper towel.

  5. 5

    Place tsipoura on hot grates. Grill without moving for 6–7 minutes until skin is charred and crispy.

  6. 6

    Flip carefully. Grill the second side 5–6 minutes until flesh flakes easily at the thickest part.

  7. 7

    Transfer to a serving platter. Drizzle with any pan juices. Serve hot with lemon wedges.

Tools you’ll need

  • charcoal or gas grill
  • long-handled tongs
  • paper towels
  • pastry brush
  • knife for scoring
  • serving platter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.