CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Grilled Tsipura with Lemon & Herbs

Whole Mediterranean sea bream grilled until the skin crisps and flesh stays tender, finished with a squeeze of fresh lemon and a drizzle of quality olive oil. Restaurant-quality in 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
42g
Grilled Tsipura with Lemon & Herbs
elegantsimplegreekmediterraneanfishcrispytenderjuicy

Ingredients

  • 2 fish (1–1.5 lb each) whole tsipura (sea bream), gutted and scaled
  • 3 tbsp olive oil
  • 2 whole lemon
  • 4 sprigs fresh oregano or thyme sprigs
  • 3 cloves, lightly crushed garlic cloves
  • 1 to taste sea salt and black pepper

Instructions

  1. 1

    Pat the fish dry inside and out with paper towels. Stuff each cavity with lemon slices, herb sprigs, and crushed garlic.

  2. 2

    Rub the exterior generously with olive oil, then season all over with salt and black pepper.

  3. 3

    Heat a grill or grill pan over medium-high until a drop of water sizzles on contact, about 2 minutes.

  4. 4

    Lay the fish on the grill without moving. Cook 7–8 minutes until the skin is charred and crispy.

  5. 5

    Flip gently and cook the other side 6–7 minutes until the flesh flakes at the thickest point near the spine.

  6. 6

    Transfer to a plate, squeeze fresh lemon juice over the top, and drizzle with best-quality olive oil. Serve immediately.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • tongs or fish spatula
  • cutting board
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.