CookSnap is coming soon — Join the waitlist →

Grilled Sea Bream with Lemon & Herbs

Whole fish brushed with oil and herbs, grilled until flaky with charred skin. Served with lemon slices for brightness — ready in 15 minutes.

Total time
15 min
Servings
2
Calories
280
Protein
36g
Grilled Sea Bream with Lemon & Herbs
freshsimpleisraelifishflakycrispyweeknightdate-night

Ingredients

  • 2 fish (12 oz each) whole sea bream (or porgy), cleaned and scaled
  • 3 tbsp olive oil
  • 1.5 whole lemon
  • 2 tbsp fresh parsley or dill, chopped
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Pat fish dry with paper towels inside and out. Score the thickest part of the fish 2-3 times on each side.

  2. 2

    Brush fish inside and out with olive oil. Season generously with salt and pepper, then sprinkle herbs inside the cavity.

  3. 3

    Heat grill to medium-high (or heat a cast iron skillet over medium-high until smoking). Oil the grate lightly.

  4. 4

    Grill fish 5–6 minutes per side without moving — skin should blister and char, flesh should flake at the thickest point.

  5. 5

    Transfer to a plate. Slice lemon into thin rounds and serve alongside the fish.

Tools you’ll need

  • grill or 12-inch cast iron skillet
  • tongs
  • paper towels
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.