CookSnap is coming soon — Join the waitlist →
Back to recipes

Grilled Lemon Herb Fish with Crispy Skin

Whole sea bream or similar white fish charred over high heat with fresh lemon, herbs, and olive oil — the Israeli way. Flaky, bright, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
38g
Grilled Lemon Herb Fish with Crispy Skin
elegantsimpleisraelimediterraneanfishcrispyflakytender

Ingredients

  • 2 fillets or small fish (8 oz each) whole sea bream or white fish (scaled and gutted)
  • 1.5 whole, divided lemon
  • ⅓ cup, chopped fresh herbs (parsley, dill, or thyme)
  • 3 tbsp olive oil
  • 2 cloves, minced garlic
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Pat fish dry inside and out with paper towels. Score the skin crosswise three times on each side.

  2. 2

    Heat a grill or grill pan over high heat until it smokes lightly, about 3 minutes.

  3. 3

    Mix olive oil, garlic, and chopped herbs in a small bowl. Rub all over fish, inside and out. Season generously with salt and pepper.

  4. 4

    Slice half the lemon into thin rounds. Stuff inside each fish cavity. Place fish on hot grill skin-side down.

  5. 5

    Sear 5–6 minutes without moving until skin is charred and crispy. Flip once and cook 3–4 minutes more until flesh flakes easily.

  6. 6

    Transfer to a plate. Squeeze remaining lemon juice over fish and serve immediately.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • small mixing bowl
  • fish spatula
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Mediterranean recipes →