Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Chicken with Coconut Rice

A fragrant coconut rice served with juicy grilled chicken, crisp crackers, cool cucumber, and a spicy-sweet sambal relish. This Malaysian-inspired plate is a quick weeknight escape.

Total time
35 min
Servings
4
Calories
580
Protein
32g
Grilled Chicken with Coconut Rice
comfortingexoticmalaysiangluten-freechickentendercrispyweeknight dinner

Ingredients

  • 4 whole chicken thighs
  • 1 cup coconut milk
  • 1 cup jasmine rice
  • 2 tablespoons sambal oelek
  • 2 tablespoons soy sauce
  • 1 tablespoon brown sugar
  • 1 medium cucumber
  • 1 cup prawn crackers

Instructions

  1. 1

    Whisk sambal, soy sauce, and brown sugar in a bowl. Add chicken and coat well; marinate 15 minutes.

  2. 2

    Rinse rice, then combine with coconut milk and 1 cup water in a pot. Bring to a boil, cover, and simmer 15 minutes.

  3. 3

    Remove from heat and let rice sit, covered, for 5 minutes. Fluff with a fork.

  4. 4

    Grill chicken over medium-high heat, turning once, until charred and cooked through, about 6 minutes per side.

  5. 5

    Slice cucumber into rounds. Serve chicken over rice with cucumber and prawn crackers on the side.

  6. 6

    Drizzle any extra marinade over the chicken if desired.

Tools you’ll need

  • grill or grill pan
  • pot with lid
  • mixing bowl
  • whisk
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.