CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Grilled Chicken Isaw

Skewered chicken intestines marinated in vinegar and soy sauce, then grilled until charred and tender. A beloved Filipino street food with tangy, savory flavor and crispy edges.

Total time
25 min
Servings
2
Calories
185
Protein
22g
Grilled Chicken Isaw
casualfilipinochickencrispytenderchewyweeknightstreet-food

Ingredients

  • ¾ lb chicken intestines, cleaned and trimmed
  • 3 tbsp soy sauce
  • 3 tbsp white vinegar
  • 3 clove garlic cloves, minced
  • ½ tsp black pepper
  • 1 tbsp olive oil

Instructions

  1. 1

    Rinse the chicken intestines under cold running water, then pat them dry with paper towels to remove excess moisture, which helps them grill better.

  2. 2

    Cut the intestines into 3-inch segments, about the width of your index finger, then thread them onto 6 to 8 wooden skewers alternating back and forth so they lay flat and cook evenly.

  3. 3

    Pour 3 tablespoons soy sauce and 3 tablespoons white vinegar into a shallow bowl, add 3 minced garlic cloves and 0.5 teaspoon black pepper, then stir until combined.

  4. 4

    Place the skewers in a single layer on a plate, then pour the marinade over them and turn them to coat all sides, ensuring every segment is moistened.

  5. 5

    Let the skewers sit in the marinade for 10 minutes at room temperature so the flavors can soak in.

  6. 6

    Preheat a grill or grill pan over medium-high heat for 2 minutes until it is hot — you should see wisps of smoke rising from the surface.

  7. 7

    Brush 1 tablespoon olive oil onto the grill grates using a paper towel held with tongs, so the skewers won't stick.

  8. 8

    Lay the skewers directly on the grill, spacing them 2 inches apart, and cook without moving them for 3 minutes until the undersides are charred dark brown.

  9. 9

    Flip each skewer and cook the other side for 2 to 3 minutes until it is also darkened and any juices that escape look clear instead of pink.

  10. 10

    Transfer the skewers to a plate and let them rest for 1 minute so the exterior stays crispy while you carry them to the table.

Tools you’ll need

  • 6 to 8 wooden skewers (soaked in water for 15 minutes before grilling)
  • shallow bowl
  • grill or grill pan
  • tongs
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.