Custrd is out on the App Store — Download it free →
Back to recipes

Greek Salad with Crispy Cheese & Fish Roe

A shareable Greek feast: juicy tomatoes, cool cucumbers, and creamy feta tossed in oregano-lemon dressing, topped with golden-fried saganaki cheese and briny taramosalata. Fresh, salty, and entirely no-cook except for the cheese.

Total time
18 min
Servings
2
Calories
485
Protein
22g
Greek Salad with Crispy Cheese & Fish Roe
freshcasuallightgreekvegetariancheesecrispycreamy

Ingredients

  • 2 whole tomatoes, large
  • 1 whole cucumber, English or seedless
  • 200 g feta cheese, block
  • ¾ cup Kalamata olives, pitted
  • 200 g saganaki cheese (fried halloumi or kefalotyri)
  • ¼ cup taramosalata (fish roe dip)
  • 1 whole lemon
  • 1 tsp dried oregano

Instructions

  1. 1

    Cut tomatoes into wedges, cucumber into half-moons. Crumble feta into bite-size chunks.

  2. 2

    Heat olive oil in a skillet over medium-high until it shimmers, about 1 minute.

  3. 3

    Slice saganaki into 1/4-inch planks. Fry 90 seconds per side until golden and crispy.

  4. 4

    Toss tomatoes, cucumber, feta, and olives in a large bowl with juice of half the lemon, oregano, salt, and pepper.

  5. 5

    Divide salad between plates. Top each with a piece of warm fried cheese and a dollop of taramosalata.

  6. 6

    Drizzle with olive oil and remaining lemon juice. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • 12-inch skillet
  • slotted spatula
  • lemon juicer or fork
  • serving plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.