CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Golden Butter Croissants

Buttery, flaky croissants with caramelized edges, baked until golden in under 20 minutes using store-bought puff pastry. A French bakery moment on a weeknight.

Total time
18 min
Servings
4
Calories
298
Protein
4g
Golden Butter Croissants
indulgentelegantfrenchvegetariancrispyflakybutteryweeknight

Ingredients

  • 1 package (about 14 oz) puff pastry sheets, thawed
  • 3 tbsp unsalted butter, melted
  • 1 tbsp granulated sugar
  • ¼ tsp kosher salt
  • 1 large egg, beaten (for egg wash)

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Unfold thawed puff pastry on a work surface. Cut each sheet into 4 triangles.

  3. 3

    Starting at the wide end, roll each triangle tightly into a croissant shape, curving the tips.

  4. 4

    Place croissants 2 inches apart on the sheet pan. Brush with beaten egg until glossy.

  5. 5

    Mix melted butter, sugar, and salt. Drizzle over croissants before baking.

  6. 6

    Bake 12–15 minutes until deep golden brown and crispy. Serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • chef's knife
  • pastry brush
  • small bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.