Golden Baked Meatballs
Four-ingredient meatballs that bake golden and crispy without browning on the stovetop. Mix, shape, and bake—ready in under 25 minutes.
- Total time
- 22 min
- Servings
- 4
- Calories
- 285
- Protein
- 24g
comfortsimpleamericanbeefcrispytenderweeknightmain-dish
Ingredients
- 1 lb ground beef
- ½ cup breadcrumbs
- 1 whole egg
- ¼ cup parmesan cheese, grated
Instructions
- 1
Preheat oven to 400°F and line a baking sheet with parchment paper.
- 2
Mix ground beef, breadcrumbs, egg, and parmesan with a pinch of salt and pepper until just combined.
- 3
Roll the mixture into 1.5-inch balls and space them 1 inch apart on the baking sheet.
- 4
Bake 15-18 minutes until the edges turn deep golden and the centers are cooked through.
- 5
Serve hot with marinara, ranch, or your favorite dipping sauce.
Tools you’ll need
- oven
- baking sheet
- parchment paper
- mixing bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
