CookSnap is coming soon — Join the waitlist →
Back to recipes

German Potato Soup

Creamy, comforting kartoffelsuppe with tender potatoes, onions, and vegetable broth finished with a touch of cream. Ready in 30 minutes.

Total time
30 min
Servings
4
Calories
285
Protein
6g
German Potato Soup
comfortwholesomegermanvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1.5 lb potatoes, unpeeled
  • 1 medium onion, yellow
  • 6 cups vegetable broth
  • ½ cup heavy cream
  • 2 tablespoons butter
  • 1 pinch salt and pepper

Instructions

  1. 1

    Rinse the potatoes under cold water, then cut each one in half lengthwise and place cut-side down on a cutting board. Slice straight down through each half into 1/2-inch-thick pieces, working from one end to the other so you get flat slices, not chunks.

  2. 2

    Slice the onion in half from root to tip, then place each flat-side down on the cutting board and slice crosswise into thin half-moon pieces about 1/4 inch thick.

  3. 3

    Place the pot over medium heat and add the 2 tablespoons of butter, tilting the pot to coat the bottom evenly. When the butter stops foaming and looks light golden, about 1 minute, you are ready to add onions.

  4. 4

    Pour the sliced onions into the pot and stir with a wooden spoon once every 30 seconds, scraping the bottom, until the onions turn soft and translucent with no hard pieces left, about 5 minutes.

  5. 5

    Pour in the 6 cups of vegetable broth and add all the sliced potatoes, stirring once to make sure everything is wet. Increase the heat to medium-high and cover the pot with a lid.

  6. 6

    Wait until you hear a strong, steady boil coming from under the lid and see steam escaping from the sides, about 8 minutes, then remove the lid.

  7. 7

    Uncover and reduce the heat to medium. Stir the soup once every 45 seconds with a wooden spoon until all the potato pieces are very soft and fall apart when pressed gently against the side of the pot, about 12 minutes.

  8. 8

    Pour in the 0.5 cup of heavy cream and stir for 30 seconds until the soup turns pale and uniform in color, then taste with a clean spoon.

  9. 9

    Add salt and pepper, stir, taste again, and keep adding salt and pepper in small pinches until the soup tastes salty and flavorful — like seasoned chicken broth.

  10. 10

    Ladle the soup into bowls, dividing the potatoes and broth evenly among four servings.

Tools you’ll need

  • chef's knife
  • cutting board
  • 6-quart pot with lid
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.