Potato Leek Soup
Silky, comforting soup with tender potatoes and sweet leeks finished with a splash of cream. Ready in under 30 minutes with just six ingredients.
- Total time
- 25 min
- Servings
- 4
- Calories
- 268
- Protein
- 4g
comfortwholesomefrenchvegetariancreamytenderweeknightcozy
Ingredients
- 2 tbsp butter
- 4 medium leeks, white and light green parts, sliced into 1/2-inch rounds
- 1.5 lbs potatoes, peeled and cut into 1/2-inch cubes
- 4 cups chicken or vegetable broth
- ½ cup heavy cream
- 1 pinch salt and black pepper to taste
Instructions
- 1
Melt butter in a large pot over medium heat until foaming, about 1 minute.
- 2
Add leeks and stir. Cook until softened and translucent, 5–6 minutes.
- 3
Add potatoes and broth. Bring to a boil, then reduce heat and simmer 10 minutes.
- 4
Potatoes should be fork-tender. Stir in cream and season with salt and pepper.
- 5
Simmer 2 more minutes to warm through. Taste and adjust seasoning.
- 6
Serve hot in bowls.
Tools you’ll need
- large pot (4-quart minimum)
- chef's knife
- cutting board
- wooden spoon
- serving spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
