CookSnap is coming soon — Join the waitlist →
Back to recipes

French Endive and Blue Cheese Salad

Crisp endive leaves tossed with creamy blue cheese, toasted walnuts, and a simple Dijon vinaigrette. A classic French bistro salad ready in 10 minutes.

Total time
10 min
Servings
2
Calories
280
Protein
8g
French Endive and Blue Cheese Salad
elegantlightfrenchvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 3 heads (about 12 oz) endive
  • 3 oz blue cheese, crumbled
  • ½ cup walnuts, toasted
  • 1 tbsp shallot, minced
  • ½ tsp Dijon mustard
  • 1 tbsp red wine vinegar

Instructions

  1. 1

    Separate endive leaves by removing outer layer. Rinse and pat dry.

  2. 2

    Whisk together mustard, vinegar, and shallot in a small bowl.

  3. 3

    While whisking, slowly drizzle in 2 tbsp olive oil until emulsified.

  4. 4

    Arrange endive leaves on a platter. Drizzle with dressing.

  5. 5

    Scatter blue cheese and walnuts over the top. Serve immediately.

Tools you’ll need

  • cutting board
  • small bowl
  • whisk
  • serving platter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.