CookSnap is coming soon — Join the waitlist →
Back to recipes

French Anchovy & Onion Tart

A classic Provençal pissaladière with caramelized onions, salty anchovies, and briny olives on a crispy sheet-pan crust. Rich, savory, and ready in under 30 minutes.

Total time
28 min
Servings
4
Calories
385
Protein
8g
French Anchovy & Onion Tart
rusticelegantfrenchmediterraneanfishcrispytenderweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • ¾ teaspoon salt and pepper
  • 5 tablespoons olive oil, divided
  • 4 medium yellow onions
  • 12 fillets anchovy fillets in oil
  • ½ cup pitted black olives

Instructions

  1. 1

    Pour 1.5 cups flour and 0.75 teaspoon salt into a large bowl and stir with a fork until combined.

  2. 2

    Add 3 tablespoons olive oil to the flour and stir with a fork until the mixture looks like wet sand with pea-sized lumps throughout, about 60 seconds.

  3. 3

    Add 4 to 5 tablespoons of cold water, one tablespoon at a time, stirring gently with a fork after each addition until the dough just holds together in a shaggy ball.

  4. 4

    Turn the dough out onto a 13 × 9-inch sheet pan and press it with your fingers into an even, thin layer covering the entire pan, about 1/4-inch thick.

  5. 5

    Place the four medium onions root-side down on a cutting board and slice them lengthwise from root to tip into 1/4-inch-thick strips, keeping layers separate.

  6. 6

    Heat 2 tablespoons olive oil in a large skillet over medium heat until it shimmers and slides quickly when tilted, about 90 seconds.

  7. 7

    Add the sliced onions and 0.25 teaspoon salt to the hot oil and stir with a wooden spoon to coat evenly.

  8. 8

    Cook the onions, stirring once every 45 seconds, until they turn deep golden brown and very soft, about 8 to 10 minutes—they should look jam-like, not wet.

  9. 9

    Set the oven to 425°F and wait until the indicator light or beep signals it has fully heated, about 10 minutes.

  10. 10

    Spread the golden caramelized onions in an even layer over the dough on the sheet pan, leaving a 1-inch border around the edges.

  11. 11

    Arrange the twelve anchovy fillets in a crosshatch pattern across the onions, spacing them about 1 inch apart so they look like a grid.

  12. 12

    Scatter the pitted black olives evenly over the surface in the gaps between the anchovies.

  13. 13

    Slide the sheet pan into the preheated oven and bake until the crust edges are golden brown and the surface looks dry, about 10 to 12 minutes.

  14. 14

    Remove the pan from the oven using oven mitts and let it cool for 3 minutes, then cut into 8 squares and serve warm or at room temperature.

Tools you’ll need

  • 13 × 9-inch sheet pan
  • large mixing bowl
  • fork
  • cutting board
  • chef's knife
  • large skillet (10-inch)
  • wooden spoon
  • oven mitts
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.