4-Ingredient Butter Cookies
Ultra-simple drop cookies made from just butter, sugar, flour, and egg. Mix, drop, bake—done in 20 minutes.
- Total time
- 20 min
- Servings
- 12
- Calories
- 156
- Protein
- 2g
simpleamericanvegetariancrispytenderweeknightcookiedessert
Ingredients
- ½ cup butter, softened
- ¾ cup sugar
- 1 whole egg
- 1.5 cups flour
Instructions
- 1
Preheat oven to 350°F and line a baking sheet with parchment.
- 2
Beat butter and sugar together until light and fluffy, about 2 minutes.
- 3
Add egg and mix until combined.
- 4
Stir in flour until no dry streaks remain.
- 5
Drop spoonfuls onto the sheet, spacing them 1 inch apart.
- 6
Bake 10–12 minutes until edges turn golden; centers stay soft.
Tools you’ll need
- oven
- baking sheet
- parchment paper
- mixing bowl
- electric mixer or whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
