CookSnap is coming soon — Join the waitlist →
Back to recipes

Fish Chermoula

Pan-seared white fish coated in a vibrant Moroccan herb sauce of cilantro, parsley, garlic, lemon, and spices. Bright, garlicky, and ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
38g
Fish Chermoula
freshelegantmoroccanfishtendercrispyweeknightdate-night

Ingredients

  • 1 cup fresh cilantro, packed
  • ½ cup fresh parsley, packed
  • 3 clove garlic cloves
  • 3 tablespoon lemon juice
  • ¼ cup olive oil
  • ½ teaspoon ground cumin
  • ¼ teaspoon paprika
  • 1 pinch salt and pepper to taste
  • 2 fillet white fish fillets (cod, halibut, or sea bass)
  • 1 tablespoon olive oil

Instructions

  1. 1

    Chop the cilantro and parsley into pieces about the size of your thumb, discarding any thick stems, and place them in a food processor bowl.

  2. 2

    Peel the garlic cloves and drop them whole into the food processor with the herbs.

  3. 3

    Pour in the lemon juice, 0.25 cup of olive oil, cumin, paprika, and a pinch each of salt and pepper.

  4. 4

    Pulse the food processor 8–10 times until the mixture becomes a chunky paste with visible herb flecks, not a smooth purée.

  5. 5

    Pat the fish fillets completely dry with a clean kitchen towel or paper towels.

  6. 6

    Place a 10-inch nonstick or regular skillet over medium-high heat and pour in 1 tablespoon of olive oil.

  7. 7

    Wait until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  8. 8

    Carefully lay each fish fillet skin-side down (or presentation-side down) in the hot oil, working away from your body to avoid splashes.

  9. 9

    Cook without moving the fish for 4–5 minutes until the bottom turns opaque and the edges begin to look cooked through.

  10. 10

    Using a thin metal spatula, flip each fillet carefully and cook the other side for 2–3 minutes until it flakes easily when poked with a fork.

  11. 11

    Transfer each fish fillet to a serving plate.

  12. 12

    Spoon half of the chermoula sauce in a generous coat over each fillet, covering the top and letting some drip down the sides.

Tools you’ll need

  • food processor
  • 10-inch skillet (nonstick or regular)
  • paper towels or clean kitchen towel
  • thin metal spatula
  • 2 serving plates
  • fork (for testing doneness)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.