CookSnap is coming soon — Join the waitlist →
Back to recipes

Moroccan Stuffed Sardines

Whole fresh sardines stuffed with a fragrant paste of cilantro, garlic, and warm spices, then pan-fried until crispy. A vibrant, elegant dish ready in 20 minutes.

Total time
20 min
Servings
2
Calories
320
Protein
28g
Moroccan Stuffed Sardines
elegantfreshmoroccanfishcrispytenderweeknightdate-night

Ingredients

  • 4 sardines fresh whole sardines, cleaned and gutted
  • ½ cup fresh cilantro, leaves only
  • 2 cloves garlic cloves
  • ½ teaspoon ground cumin
  • ¼ teaspoon paprika
  • 3 tablespoons olive oil
  • 1 pinch salt and pepper

Instructions

  1. 1

    Mince the garlic until the pieces are the size of pencil-tip dots, smaller than a grain of rice.

  2. 2

    Chop the cilantro leaves roughly into pieces about the size of your fingernail — no need for fine uniformity.

  3. 3

    In a small bowl, stir together the minced garlic, chopped cilantro, cumin, paprika, and a pinch of salt and pepper until the mixture looks uniform and fragrant.

  4. 4

    Pat each sardine dry inside and out with a clean kitchen towel or paper towels, working gently to avoid tearing the skin.

  5. 5

    Spoon about 1 teaspoon of the cilantro-garlic filling into the cavity of each sardine, dividing it evenly among the four fish.

  6. 6

    Heat 3 tablespoons of olive oil in a 12-inch skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  7. 7

    Lay the stuffed sardines flat in the hot oil in a single layer, without crowding; you should hear an immediate, steady sizzle.

  8. 8

    Cook without moving them for 2 minutes, until the skin begins to look golden and the edges darken slightly.

  9. 9

    Using a thin metal spatula, carefully slide it under each sardine and flip it over in one smooth motion.

  10. 10

    Cook the second side for another 2 minutes, until the skin is golden all over and the fish feels firm to a gentle prod with your finger.

  11. 11

    Transfer the sardines to a serving plate and taste a small piece; add a pinch more salt if needed.

Tools you’ll need

  • small mixing bowl
  • 12-inch skillet
  • thin metal spatula
  • paper towels
  • teaspoon
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.