10-Minute English Muffin Pizzas
Split English muffins, top with pizza sauce and melted mozzarella, then broil until bubbly and golden. A cheesy, crispy-edged snack or quick lunch that's ready in minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 14g
quickcasualamericanvegetariancheesecrispymeltyweeknight
Ingredients
- 2 whole english muffins
- ½ cup pizza sauce
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Split the English muffins in half and place them cut-side up on a baking sheet.
- 2
Spread about 2 tablespoons of pizza sauce on each muffin half.
- 3
Divide the mozzarella evenly among the four muffin halves, covering the sauce.
- 4
Broil 4 inches from the heat for 2–3 minutes until cheese melts and edges brown.
- 5
Serve hot straight from the oven.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
