Custrd is out on the App Store — Download it free →
Back to recipes

Eggplant and Pork Stir-Fry

A quick and savory stir-fry with tender pork, eggplant, and crisp vegetables in a soy-based sauce. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
2
Calories
420
Protein
28g
Eggplant and Pork Stir-Fry
comfortingChinesedairy-freeporktendercrispweeknightstir-fry

Ingredients

  • 1 large eggplant
  • 8 oz pork (thinly sliced)
  • 1 cup green beans
  • 1 medium carrot
  • 3 tbsp soy sauce
  • 2 tbsp vegetable oil

Instructions

  1. 1

    Cut the 1 large eggplant into 1-inch chunks and the 1 medium carrot into thin rounds. Trim the 1 cup green beans. Pat the 8 oz pork dry with paper towels.

  2. 2

    Heat 1 tbsp of the 2 tbsp vegetable oil in a large skillet over high heat. Add the pork in a single layer and cook until browned on both sides, about 3 minutes. Transfer to a plate.

  3. 3

    Add the remaining 1 tbsp oil to the skillet. Add the eggplant, carrot, and green beans. Stir-fry until the eggplant is golden and tender, about 5 minutes.

  4. 4

    Return the pork to the skillet. Add the 3 tbsp soy sauce and 2 tbsp water. Stir-fry for 1-2 minutes until the sauce coats everything and the pork is cooked through.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.