CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ebi Mayo Shrimp

Crispy fried shrimp coated in a creamy, tangy Japanese mayo sauce with a hint of sweetness. Ready in under 20 minutes with just a few pantry staples.

Total time
20 min
Servings
2
Calories
420
Protein
22g
Ebi Mayo Shrimp
indulgentsatisfyingjapaneseshrimpcrispytendercreamyweeknight

Ingredients

  • ½ lb large shrimp, peeled and deveined
  • ¼ cup cornstarch
  • 1 whole eggs
  • ½ cup Japanese mayonnaise
  • 2 tbsp sweetened condensed milk
  • 1 pinch salt and pepper

Instructions

  1. 1

    Pat the shrimp dry with paper towels by gently pressing each shrimp against a towel to remove surface moisture, so they will crisp properly when fried.

  2. 2

    Crack the egg into a shallow bowl and beat it with a fork until the white and yolk are fully mixed and uniform in color.

  3. 3

    Pour the cornstarch into a separate shallow bowl or small plate.

  4. 4

    Mix the Japanese mayonnaise and sweetened condensed milk together in a small bowl, stirring with a spoon until completely smooth and uniform, about 30 seconds, so the sauce is creamy and slightly sweet.

  5. 5

    Heat 1 tablespoon of oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. 6

    Take one shrimp, dip it into the beaten egg so it is fully coated, then roll it in the cornstarch until all sides are covered and white.

  7. 7

    Place the coated shrimp into the hot oil and repeat with remaining shrimp until the skillet is full but not crowded, working in batches if needed.

  8. 8

    Cook the shrimp until the coating turns light golden brown and the shrimp just begins to curl, about 2 to 3 minutes per side, flipping once with tongs.

  9. 9

    Transfer the cooked shrimp to a clean plate using tongs.

  10. 10

    Repeat steps 6–9 with remaining shrimp, adding another 1 tablespoon of oil if the skillet looks dry.

  11. 11

    Pour the mayo mixture into a small bowl and add a pinch of salt and pepper, stirring once to combine.

  12. 12

    Arrange the fried shrimp on a serving plate, then drizzle the mayo sauce over the top until the shrimp are lightly coated.

Tools you’ll need

  • 12-inch skillet
  • 3 shallow bowls or plates
  • fork
  • spoon
  • paper towels
  • tongs
  • small serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.