Curry Dishes
A rich and aromatic curry with tender meat chunks, soft onions, and a creamy sauce, garnished with fresh cilantro and whole star anise.
- Total time
- 50 min
- Servings
- 4
- Calories
- 450
- Protein
- 35g
comfortingIndiangluten-freemeatcreamytenderweeknightcurry
Ingredients
- 500 g meat chunks
- 1 large onion
- 1 bunch cilantro
- 200 ml cream
- 2 pieces star anise
- 2 tbsp curry powder
- 3 cloves garlic
- 1 inch ginger
- 2 tbsp oil
- 1 tsp salt
Instructions
- 1
Heat oil in a pot and sauté chopped onions until golden brown.
- 2
Add minced garlic and ginger, cook for 1 minute until fragrant.
- 3
Add meat chunks and brown on all sides for 5 minutes.
- 4
Stir in curry powder and star anise, cook for 2 minutes.
- 5
Pour in 2 cups water, cover and simmer for 30 minutes until meat is tender.
- 6
Stir in cream and simmer for 5 minutes until sauce thickens.
- 7
Garnish with fresh cilantro and serve hot.
Tools you’ll need
- large pot
- wooden spoon
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
