CookSnap is coming soon — Join the waitlist →

10-Min Crispy Veggie Fajitas

Bell peppers and onions hit a screaming-hot skillet until charred and tender, then wrapped in warm tortillas with a lime crema and fresh cilantro. No beans, no rice—just pure fajita energy in under 10 minutes.

Total time
10 min
Servings
2
Calories
280
Protein
6g
10-Min Crispy Veggie Fajitas
quickcasualtex-mexvegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 large bell peppers (red, yellow, or orange), sliced into 1/4-inch strips
  • 1 medium yellow onion, sliced into 1/4-inch strips
  • ½ cup sour cream
  • 1 whole lime (zested + juiced)
  • 6 count flour tortillas
  • ¼ cup fresh cilantro, chopped
  • 1 tsp chili powder or smoked paprika

Instructions

  1. 1

    Stir sour cream with lime juice, zest, salt, and pepper until smooth and creamy.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add peppers and onion. Sprinkle with chili powder, salt, and pepper. Cook without stirring for 3 minutes until charred.

  4. 4

    Stir the vegetables and cook for 2 more minutes until edges curl and soften slightly.

  5. 5

    Warm tortillas in the skillet for 30 seconds per side, or in a dry skillet if you prefer.

  6. 6

    Fill tortillas with veggies, drizzle with lime crema, and top with fresh cilantro. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.