CookSnap is coming soon — Join the waitlist →

20-Min Crispy Vegetable Bibimbap Bowl

A vibrant Korean rice bowl loaded with sautéed vegetables, a fried egg, and gochujang sauce — ready in 20 minutes flat. Serve with miso soup on the side for a complete meal.

Total time
20 min
Servings
2
Calories
485
Protein
12g
20-Min Crispy Vegetable Bibimbap Bowl
satisfyingquickkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked white or brown rice
  • 3 cups mixed vegetables (carrots, zucchini, spinach, mushrooms), sliced thin
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 2 whole eggs
  • 2 stalks green onion (white and light green parts), chopped
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Stir gochujang with 1 tbsp sesame oil, 1 tbsp water, and a pinch of salt until smooth.

  2. 2

    Heat 1 tbsp sesame oil in a large skillet over medium-high until shimmering, about 1 minute.

  3. 3

    Add vegetables and cook, stirring, until tender and lightly browned, about 5 minutes.

  4. 4

    Push vegetables to the side of the skillet. Crack eggs into the empty space and fry until whites set but yolks jiggle, 3–4 minutes.

  5. 5

    Divide rice between two bowls. Top with sautéed vegetables, a fried egg, and a spoonful of gochujang sauce.

  6. 6

    Sprinkle with green onion and sesame seeds. Stir everything together before eating.

Tools you’ll need

  • large skillet (12-inch minimum)
  • mixing bowl
  • two serving bowls
  • cooking spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.