CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Tostadas with Charred Corn & Queso

Crunchy corn tostadas loaded with charred corn, melted cheese, and bright lime crema. Sheet-pan dinner that tastes like a taquería in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Crispy Tostadas with Charred Corn & Queso
quickcasualmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 shells corn tostada shells
  • 1.5 cups fresh corn kernels (or frozen, thawed)
  • 1 cup sharp cheddar or cotija cheese, shredded
  • ½ cup sour cream
  • 1 whole lime
  • 1 whole jalapeño, sliced thin (or pickled)

Instructions

  1. 1

    Heat a large skillet over medium-high heat. Toss corn with a pinch of salt and spread in a single layer.

  2. 2

    Cook corn without stirring until charred on one side, ~3 minutes. Stir and cook another 2 minutes until edges are dark.

  3. 3

    Arrange tostada shells on the skillet (work in batches if needed). Top each with a handful of cheese.

  4. 4

    Cover with a lid or foil and cook over medium heat until cheese melts and shells are warm, ~2 minutes.

  5. 5

    Stir sour cream with the juice of half the lime. Season with salt to taste.

  6. 6

    Top each tostada with charred corn, a drizzle of lime crema, and a few jalapeño slices. Serve immediately.

Tools you’ll need

  • 12-inch skillet with lid or foil
  • cutting board and knife
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.