Crispy Tlayudas with Refried Beans & Cheese
Oaxacan-style fried tortillas topped with refried beans, melted cheese, and fresh toppings. Crispy, savory, and ready in 20 minutes using a sheet pan.
- Total time
- 20 min
- Servings
- 2
- Calories
- 385
- Protein
- 12g

casualsatisfyingmexicanvegetariancheesecrispymeltyweeknight
Ingredients
- 4 whole corn tortillas, 6-inch diameter
- ¾ cup refried beans
- 1 cup shredded Oaxaca or mozzarella cheese
- 3 tbsp olive oil
- 1 medium fresh tomato, diced
- ¼ medium white onion, thinly sliced
- 1 pinch salt and black pepper to taste
Instructions
- 1
Heat oven to 400°F. Line a sheet pan with parchment paper.
- 2
Brush both sides of each tortilla lightly with olive oil. Arrange on the sheet pan.
- 3
Bake tortillas 5–6 minutes until they start to turn golden and crisp at edges.
- 4
Remove pan from oven. Spread 3 tablespoons refried beans on each tortilla.
- 5
Top each with 1/4 cup cheese. Return to oven for 4–5 minutes until cheese melts.
- 6
Top tlayudas with diced tomato, sliced onion, salt, and pepper. Serve hot.
Tools you’ll need
- sheet pan
- parchment paper
- oven
- pastry brush
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



