Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Tacos

Golden, crunchy tacos filled with seasoned beef, melted cheese, and fresh toppings. A fun weeknight dinner that's ready in about 40 minutes.

Total time
40 min
Servings
4
Calories
480
Protein
28g
Crispy Tacos
comfortingMexicanbeefcrispyweeknightmaindinnerpan-fried

Ingredients

  • 8 count corn tortillas
  • 1 lb ground beef
  • 1 medium onion
  • 1 medium green bell pepper
  • 1 cup shredded cheddar cheese
  • 3 tbsp vegetable oil
  • 1 tsp chili powder
  • 1 tsp salt

Instructions

  1. 1

    Heat 1 tbsp vegetable oil in a skillet over medium heat. Add 1 diced onion and 1 diced green pepper; cook until soft, about 5 minutes.

  2. 2

    Add 1 lb ground beef and 1 tsp salt; cook, breaking up meat, until browned, about 8 minutes. Stir in 1 tsp chili powder and remove from heat.

  3. 3

    Warm 8 corn tortillas in a dry skillet or microwave until pliable. Fill each with beef mixture and 2 tbsp shredded cheddar cheese; fold in half.

  4. 4

    Heat remaining 2 tbsp oil in a large skillet over medium-high. Cook tacos in batches, 2-3 minutes per side, until golden and crispy.

  5. 5

    Serve hot with lime wedges, cilantro, and red chili flakes if desired.

Tools you’ll need

  • skillet
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.