CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Spicy Shrimp Dynamite Roll

Tempura shrimp tossed in a fiery mayo-sriracha glaze, served over sushi rice with avocado and cucumber. One skillet, 20 minutes, pure sushi-bar energy.

Total time
20 min
Servings
2
Calories
520
Protein
24g
Crispy Spicy Shrimp Dynamite Roll
indulgentsatisfyingjapaneseshrimpcrispytendercreamyweeknight

Ingredients

  • 12 count large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • 3 tbsp soy sauce
  • 2 tbsp sriracha
  • 3 tbsp mayonnaise
  • 2 cups cooked sushi rice
  • 1 whole avocado, sliced

Instructions

  1. 1

    Mix sriracha, mayo, and 1 tbsp soy sauce in a small bowl until smooth.

  2. 2

    Pat shrimp dry. Toss with flour, salt, and pepper until evenly coated.

  3. 3

    Heat 1 inch of neutral oil in a skillet to 350°F. Working in two batches, fry shrimp until golden and crispy, about 2 minutes per batch.

  4. 4

    Transfer fried shrimp to paper towels. Toss with the sriracha mayo while still warm.

  5. 5

    Divide sushi rice between two bowls. Top with glazed shrimp, avocado slices, and a drizzle of extra sauce.

  6. 6

    Serve immediately with extra soy sauce on the side.

Tools you’ll need

  • 9-inch skillet or small saucepan
  • candy/deep-fry thermometer
  • paper towels
  • small mixing bowl
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Japanese recipes →