CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Crispy Shrimp Crepes with Dipping

Instant crepes stuffed with crispy shrimp, fresh herbs, and cool cucumber—no batter required. Serve with fish sauce dip and mango for an authentic Vietnamese street-food snap.

Total time
15 min
Servings
2
Calories
185
Protein
14g
15-Min Crispy Shrimp Crepes with Dipping
freshcasualvietnameseshrimpcrispytendersnackappetizer

Ingredients

  • 12 count medium shrimp, peeled and deveined
  • 8 count rice paper wrappers
  • ½ medium cucumber, thinly sliced
  • ½ cup shredded green mango
  • 1 cup fresh herbs (cilantro, mint, basil), torn
  • ½ cup fish sauce–lime dipping sauce

Instructions

  1. 1

    Pat shrimp dry and season with salt and pepper.

  2. 2

    Heat 2 tbsp oil in a skillet over medium-high. Sear shrimp 90 seconds per side until pink and curled.

  3. 3

    Dip each rice paper wrapper in warm water for 5 seconds until just pliable—don't oversoak.

  4. 4

    Lay a wrapper flat. Layer with herbs, cucumber, mango, and a shrimp in the center.

  5. 5

    Roll tightly, tucking in the sides like a spring roll, then fold in half lengthwise.

  6. 6

    Serve crepes warm with fish sauce dip on the side for dipping.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • shallow bowl or plate for water
  • paper towels
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →