CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pan Spring Rolls

Chewy rice paper wraps stuffed with shrimp, cabbage, and herbs, then pan-fried until golden and served with tangy dipping sauce. Ready in 18 minutes.

Total time
18 min
Servings
2
Calories
245
Protein
18g
Crispy Pan Spring Rolls
casualfreshvietnameseshrimpcrispychewytenderBread

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 8 wrappers rice paper wrappers
  • 2 cups cabbage, shredded
  • ½ cup fresh herbs (cilantro, mint, or basil)
  • 3 tbsp hoisin sauce
  • 1 tbsp sriracha or chili sauce
  • 1 lime lime

Instructions

  1. 1

    Pat shrimp dry and season with salt and pepper. Heat oil in a skillet over medium-high until shimmering.

  2. 2

    Cook shrimp 90 seconds per side until pink and opaque. Transfer to a plate and chop roughly.

  3. 3

    Dip rice paper into a bowl of warm water for 15 seconds until pliable. Lay on a work surface.

  4. 4

    Fill each wrapper with cabbage, herbs, and a few shrimp pieces. Fold sides inward, then roll tightly.

  5. 5

    Pan-fry rolls seam-side down in the same skillet over medium-high until golden, 2–3 minutes per side.

  6. 6

    Mix hoisin, sriracha, and a squeeze of lime juice. Serve rolls hot with the dipping sauce.

Tools you’ll need

  • 12-inch skillet
  • shallow bowl or wide dish
  • cutting board
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.