CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Sara Udon with Shrimp

Tangled crispy fried noodles topped with tender shrimp in a light, savory Japanese sauce. Crunchy, fresh, and restaurant-ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
485
Protein
22g
Crispy Sara Udon with Shrimp
lightfreshjapaneseshrimpcrispytenderchewyweeknight

Ingredients

  • 8 oz fresh ramen noodles (or crispy chow mein)
  • 8 oz shrimp, peeled and deveined
  • 3 tbsp soy sauce
  • 1 tbsp mirin (or honey)
  • 3 tbsp vegetable oil
  • 2 stalks green onions, thinly sliced
  • ½ tbsp sesame seeds (for garnish)

Instructions

  1. 1

    Boil ramen noodles in salted water for 3 minutes. Drain and set aside.

  2. 2

    Stir together soy sauce and mirin in a small bowl.

  3. 3

    Heat 1.5 tbsp oil in a large skillet over medium-high until shimmering.

  4. 4

    Add noodles in a loose nest. Fry 4–5 minutes without stirring until bottom is golden and crispy.

  5. 5

    Flip noodles and fry the other side 3–4 minutes until crispy all over. Transfer to a plate.

  6. 6

    Add remaining 1.5 tbsp oil to the skillet. Sauté shrimp until pink, 3–4 minutes.

  7. 7

    Pour soy-mirin sauce into the skillet and toss shrimp to coat, 30 seconds.

  8. 8

    Place crispy noodles on plates. Top with shrimp and sauce. Garnish with green onion and sesame seeds.

Tools you’ll need

  • large pot for boiling
  • 12-inch skillet
  • small bowl for sauce
  • spatula or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.