CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Roti Canai with Curry Dip

Flaky, buttery roti fried until golden and served with a fragrant curry dip. A TikTok-friendly shortcut using store-bought roti sheets—no rolling or laminating required.

Total time
15 min
Servings
2
Calories
410
Protein
6g
Crispy Roti Canai with Curry Dip
casualquickmalaysianvegetarianvegetariancrispyflakysoft

Ingredients

  • 4 sheets store-bought roti sheets (frozen or fresh)
  • 3 tbsp butter or ghee
  • 2 tbsp curry powder (mild or medium)
  • ¾ cup canned coconut milk
  • ½ medium onion, thinly sliced
  • 1 medium potato, diced small
  • 2 tbsp cilantro or green onion (optional, for garnish)

Instructions

  1. 1

    Heat 2 tbsp butter in a skillet over medium-high until foaming, about 1 minute.

  2. 2

    Pan-fry roti sheets one at a time until edges curl and surface is golden, ~1 minute per side.

  3. 3

    Transfer roti to a plate; repeat with remaining sheets and 1 tbsp butter.

  4. 4

    In the same skillet, add onion and potato with a pinch of salt; sauté over medium-high for 4 minutes.

  5. 5

    Stir in curry powder, cook 1 minute until fragrant, then pour in coconut milk and a pinch of salt.

  6. 6

    Simmer 3 minutes, stirring occasionally, until sauce thickens slightly and potato begins to soften.

  7. 7

    Serve roti torn into pieces alongside the curry dip, topped with cilantro if desired.

Tools you’ll need

  • 12-inch non-stick or cast iron skillet
  • wooden spoon or spatula
  • small cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.