CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Rice Stuffed Cabbage

Tender cabbage leaves wrapped around seasoned rice and herbs, pan-fried until edges crisp up. A vegetarian take on Greek lahanodolmades that skips the long simmer for a weeknight-friendly sheet-pan finish.

Total time
18 min
Servings
4
Calories
145
Protein
3g
Crispy Rice Stuffed Cabbage
comfortwholesomegreekvegetarianvegantendercrispy

Ingredients

  • ½ head green cabbage
  • 1.5 cups cooked white rice
  • ¼ cup, chopped fresh dill
  • 2 tbsp, chopped fresh mint
  • 1 whole (juiced) lemon
  • 2 tbsp olive oil

Instructions

  1. 1

    Boil water in a pot. Carefully peel off 8 whole cabbage leaves and blanch them 3 minutes until pliable.

  2. 2

    Pat leaves dry on a kitchen towel. Mix rice, dill, mint, lemon juice, salt, and pepper in a bowl.

  3. 3

    Place 3 tbsp rice mixture at the center of each leaf. Roll tightly, tucking in the sides as you go.

  4. 4

    Heat olive oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  5. 5

    Arrange rolls seam-side down in the skillet. Sear for 3 minutes until the bottom edges turn light golden.

  6. 6

    Flip and sear the other side 2 minutes. Serve hot, drizzled with extra lemon juice if desired.

Tools you’ll need

  • 12-inch skillet
  • large pot
  • mixing bowl
  • kitchen towel
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.