Crispy Ranch Baked Wings
Chicken wings coated in ranch seasoning and olive oil, baked until golden and crispy. Serve with ranch dipping sauce for the ultimate weeknight comfort meal.
- Total time
- 25 min
- Servings
- 4
- Calories
- 420
- Protein
- 38g
comfortcasualamericanchickencrispytenderweeknightgame-day
Ingredients
- 2 lbs chicken wings
- 2 tbsp ranch seasoning mix
- 3 tbsp olive oil
- ¾ cup ranch dipping sauce
Instructions
- 1
Pat chicken wings dry with paper towels, then toss with olive oil and ranch seasoning until fully coated.
- 2
Spread wings in a single layer on a sheet pan lined with foil.
- 3
Bake at 425°F for 20 minutes, shaking the pan halfway through, until edges are golden and crispy.
- 4
Serve hot with ranch dipping sauce on the side.
Tools you’ll need
- sheet pan
- aluminum foil
- paper towels
- large bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
