CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato Pancakes with Cottage Cheese

Shredded potato pancakes, golden and crispy on the outside, with a fluffy center. Serve with cold cottage cheese for a satisfying weeknight dinner that comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
9g
Crispy Potato Pancakes with Cottage Cheese
comfortsimpleamericanvegetarianeggscrispyfluffyweeknight

Ingredients

  • 1 lb potato
  • 1 large egg
  • 3 tbsp flour
  • ½ small onion
  • ¾ cup cottage cheese

Instructions

  1. 1

    Shred the potato and onion on a box grater, then squeeze out excess liquid with paper towels.

  2. 2

    Mix shredded potato and onion with egg, flour, salt, and pepper until combined.

  3. 3

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  4. 4

    Drop spoonfuls of potato mixture into the skillet, flatten with a spatula, and cook 3–4 minutes per side until golden brown.

  5. 5

    Transfer pancakes to a plate and serve hot with cottage cheese on the side.

Tools you’ll need

  • box grater
  • large skillet (10–12 inches)
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.