CookSnap is coming soon — Join the waitlist →

Crispy Poppy Seed Cheese Rolls

Hungarian-style savory pastry rolls with tart sour cream and fresh dill, baked until golden. A vegetarian weeknight dinner that tastes like it took hours.

Total time
18 min
Servings
4
Calories
348
Protein
12g
Crispy Poppy Seed Cheese Rolls
comfortsimplehungarianvegetariancheesecrispyflakytender

Ingredients

  • 8 sheets phyllo pastry sheets (thawed)
  • 2 cups sharp cheddar or Hungarian cheese, grated
  • 1 cup sour cream, divided
  • 4 tbsp butter, melted
  • 3 tbsp fresh dill, chopped (or 1.5 tsp dried dill)
  • 2 tbsp poppy seeds

Instructions

  1. 1

    Preheat oven to 400°F. Mix grated cheese, half the sour cream, dill, and a pinch each of salt and pepper in a bowl.

  2. 2

    Lay a phyllo sheet on a work surface. Brush lightly with melted butter, then spread 2–3 tbsp filling across one edge.

  3. 3

    Roll tightly from the filled edge, tucking in the sides. Place seam-side down on a parchment-lined sheet pan.

  4. 4

    Repeat with remaining phyllo sheets and filling. You'll have 8 rolls on the pan.

  5. 5

    Brush each roll with remaining butter and sprinkle poppy seeds over the top. Bake 12–14 minutes until golden brown.

  6. 6

    Serve warm with the reserved sour cream on the side for dipping.

Tools you’ll need

  • oven
  • parchment-lined sheet pan
  • mixing bowl
  • pastry brush
  • small knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.