CookSnap is coming soon — Join the waitlist →

25-Min Crispy Veggie Tart

Puff pastry crust topped with caramelized onions, roasted zucchini, tomatoes, and melted cheese — a weeknight spin on Argentine tarta de verdura. Bake until golden and slice hot.

Total time
25 min
Servings
4
Calories
385
Protein
12g
25-Min Crispy Veggie Tart
comfortrusticargentinianvegetariancheesecrispytenderweeknight

Ingredients

  • 1 sheet (thawed) frozen puff pastry sheet
  • 1 large yellow onion
  • 1 medium zucchini
  • 2 medium Roma tomatoes
  • 1 cup mozzarella cheese, shredded
  • ¼ cup Parmesan cheese, grated
  • 2 tbsp (chopped) fresh basil or parsley

Instructions

  1. 1

    Preheat oven to 425°F. Slice the onion into thin crescents and zucchini into thin rounds. Dice the tomatoes.

  2. 2

    Heat 2 tbsp olive oil in a large skillet over medium. Cook onion, stirring occasionally, until caramelized and golden, ~8 minutes.

  3. 3

    Lay puff pastry on a baking sheet. Spread caramelized onion over it, leaving a 0.5-inch border. Top with zucchini, tomatoes, then both cheeses.

  4. 4

    Bake until pastry is puffed and golden, ~12 minutes. The edges should be deeply brown and crispy.

  5. 5

    Remove from oven. Scatter fresh basil over the top. Let cool 2 minutes, slice into 4 pieces, and serve hot.

Tools you’ll need

  • baking sheet
  • large skillet
  • chef's knife
  • cutting board
  • box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.