CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Podi Dosa

Golden-brown dosa with spicy peanut-lentil powder crust. Vegan, quick, and pure comfort — ready in 20 minutes with pantry staples.

Total time
20 min
Servings
2
Calories
420
Protein
12g
Crispy Podi Dosa
comfortquickindianvegetarianvegandairy-freechickpeascrispy

Ingredients

  • 2 cups dosa batter (store-bought or pre-made)
  • ½ cup roasted peanuts, finely crushed
  • 2 whole dried red chilis, deseeded and crushed
  • 3 tbsp urad dal powder (or chickpea flour)
  • 3 tbsp coconut oil or neutral oil
  • ½ cup chutney (coconut or tamarind) for serving

Instructions

  1. 1

    Mix crushed peanuts, red chili, urad dal powder, and a pinch of salt in a bowl.

  2. 2

    Heat oil in a nonstick skillet over medium-high until it shimmers and a drop of batter sizzles instantly.

  3. 3

    Pour 1/2 cup batter onto the skillet, spread it into a thin circle with the back of a spoon.

  4. 4

    Sprinkle a thick line of podi mixture down the center, press gently so it sticks to the dosa.

  5. 5

    Cook until the bottom is golden and crispy, ~3 minutes, then flip and cook the other side for 1 minute until golden.

  6. 6

    Fold in half and serve hot with chutney on the side.

Tools you’ll need

  • 12-inch nonstick skillet or cast iron dosa pan
  • spoon or silicone spatula
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.