Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Pastel de Feira — Brazilian Fried Pastry

Golden, crispy-edged fried pastry pockets stuffed with a tangy cheese-and-green filling. Brazilian street food that's ready in 20 minutes and absolutely viral-worthy.

Total time
20 min
Servings
4
Calories
520
Protein
12g
Crispy Pastel de Feira — Brazilian Fried Pastry
casualindulgentbrazilianvegetariancheesecrispyflakysnack

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup water
  • 1 cup mozzarella cheese, shredded
  • ½ cup green onion or fresh parsley, finely chopped
  • 2 cups neutral oil for frying
  • 1 pinch salt and black pepper to taste
  • 1 whole lime wedge for serving

Instructions

  1. 1

    Mix flour, water, and a pinch of salt until a soft dough forms. Knead briefly until smooth, about 2 minutes.

  2. 2

    Divide dough into 8 balls. Roll each into a thin 4-inch circle on a floured surface.

  3. 3

    Toss mozzarella with green onion, salt, and black pepper. Spoon 2 tbsp filling onto one half of each circle.

  4. 4

    Fold dough in half to form a half-moon. Press edges firmly with a fork to seal.

  5. 5

    Heat oil in a deep skillet to 350°F. Fry pastels 90 seconds per side until deep golden and edges curl.

  6. 6

    Drain on paper towels. Serve hot with lime wedges for squeezing.

Tools you’ll need

  • mixing bowl
  • rolling pin
  • fork
  • deep skillet or heavy pot
  • deep-fry or instant-read thermometer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.