CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Parmesan Zucchini Fries

Thin zucchini strips coated in crispy breadcrumbs and parmesan, baked until golden in under 20 minutes. Serve with a simple dipping sauce and a tangy slaw for a complete weeknight dinner.

Total time
20 min
Servings
2
Calories
145
Protein
8g
Crispy Parmesan Zucchini Fries
casualcomfortamericanvegetariancrispytenderweeknightside

Ingredients

  • 3 whole zucchini, medium
  • 1 whole egg
  • ¾ cup breadcrumbs (panko preferred)
  • ¼ cup parmesan cheese, grated

Instructions

  1. 1

    Preheat oven to 425°F and line a sheet pan with parchment paper.

  2. 2

    Slice zucchini lengthwise into 1/4-inch-thick planks, then cut into 1/4-inch sticks.

  3. 3

    Whisk egg in a shallow bowl, then combine breadcrumbs and parmesan in another bowl.

  4. 4

    Dip each zucchini stick in egg, then dredge in breadcrumb mixture, pressing gently to coat.

  5. 5

    Arrange coated fries on sheet pan in a single layer, spray lightly with cooking oil.

  6. 6

    Bake 15–18 minutes until edges are golden and crispy, shaking pan halfway through.

Tools you’ll need

  • sheet pan
  • parchment paper
  • sharp knife
  • two shallow bowls
  • cooking spray

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.