CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Pan-Fried Dumplings

Frozen soup dumplings get golden and crispy in a hot skillet with minimal oil, then served with a simple soy dipping sauce. Ready in 12 minutes—the ultimate lazy dinner.

Total time
12 min
Servings
2
Calories
285
Protein
8g
Crispy Pan-Fried Dumplings
quicksatisfyingchinesecrispychewyweeknightappetizerdinner

Ingredients

  • 12 count frozen soup dumplings (fried or potsticker style)
  • 2 tbsp vegetable oil
  • 3 tbsp soy sauce

Instructions

  1. 1

    Heat oil in a 10-inch nonstick skillet over medium-high heat until shimmering, about 90 seconds.

  2. 2

    Arrange dumplings flat-side down in the skillet without crowding—work in batches if needed.

  3. 3

    Cook undisturbed for 4 minutes until the bottoms turn golden brown and crispy.

  4. 4

    Flip each dumpling and cook the second side for 2 minutes until golden.

  5. 5

    Pour soy sauce into a small bowl for dipping.

  6. 6

    Transfer dumplings to a plate and serve hot with soy sauce on the side.

Tools you’ll need

  • 10-inch nonstick skillet
  • spatula
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.