Crispy Mushroom & Walnut Tart
Buttery puff pastry topped with sautéed mushrooms, toasted walnuts, and chestnuts—ready in 20 minutes. Earthy, nutty, and impossibly elegant for a weeknight.
- Total time
- 20 min
- Servings
- 2
- Calories
- 425
- Protein
- 10g
elegantquickfrenchvegetarianvegetariancrispytenderweeknight
Ingredients
- 1 sheet (thawed) frozen puff pastry sheet
- 12 oz mushrooms, mixed (cremini, oyster)
- ½ cup walnuts
- ¼ cup chestnuts, halved
- 1 small shallot, minced
- 1 tsp fresh thyme
Instructions
- 1
Preheat oven to 400°F. Spread puff pastry on a sheet pan.
- 2
Slice mushrooms 1/4-inch thick. Remove any woody stems.
- 3
Heat 2 tbsp butter in a skillet over medium-high until foaming.
- 4
Add mushrooms and shallot. Cook, stirring often, until liquid evaporates and edges brown, ~6 minutes.
- 5
Stir in walnuts, chestnuts, and thyme. Season with salt and pepper. Spread evenly over pastry.
- 6
Bake until pastry is golden and puffed, ~12 minutes. Serve hot.
Tools you’ll need
- sheet pan
- 12-inch skillet
- chef's knife
- wooden spoon
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
