Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Msemen with Honey & Fresh Salad

Flaky, buttery square flatbread fried until golden, drizzled with warm honey and served alongside a bright cucumber-tomato salad. A Moroccan breakfast classic that feels fancy but takes just 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
6g
Crispy Msemen with Honey & Fresh Salad
simpleelegantcozymoroccanvegetariancrispyflakytender

Ingredients

  • 1.5 cups all-purpose flour
  • 4 tbsp butter, melted
  • 3 tbsp honey
  • 2 medium cucumbers, sliced
  • 2 medium tomatoes, sliced
  • 2 tbsp fresh cilantro or parsley, chopped

Instructions

  1. 1

    Mix flour with 0.5 cup water and a pinch of salt until a soft dough forms, then knead for 2 minutes until smooth.

  2. 2

    Divide dough into 2 balls. On an oiled surface, stretch one ball thin with your hands, then fold into a square.

  3. 3

    Heat 2 tbsp butter in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Pan-fry msemen 3–4 minutes per side until golden brown and crispy. Repeat with remaining dough and butter.

  5. 5

    While msemen cooks, toss cucumber and tomato slices with salt, pepper, and fresh herbs in a bowl.

  6. 6

    Drizzle warm honey over cooked msemen. Serve hot alongside the cucumber-tomato salad.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.