CookSnap is coming soon — Join the waitlist →

Crispy Mole Amarillo Empanadas with Green Salad

Golden fried empanadas stuffed with shredded chicken and rich yellow mole, served with a bright green salad and extra sauce for dipping. Restaurant-quality in 25 minutes using jarred mole as the shortcut.

Total time
25 min
Servings
2
Calories
620
Protein
28g
Crispy Mole Amarillo Empanadas with Green Salad
indulgentrusticmexicanchickencrispytenderflakyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 1 cup jarred mole amarillo (yellow mole sauce)
  • 12 pieces frozen empanada discs or wonton wrappers
  • 3 cups mixed greens (arugula, spinach, or romaine)
  • 1 whole lime
  • ¼ cup red onion, thinly sliced
  • 2 cups neutral oil for frying
  • ¼ cup cilantro or parsley, chopped

Instructions

  1. 1

    Warm 0.5 cup mole amarillo in a small skillet over medium heat, stirring occasionally, until steaming and fragrant, 2 minutes.

  2. 2

    Mix shredded chicken with warm mole in a bowl until coated; taste and season with salt and pepper.

  3. 3

    Lay out empanada discs. Place 2 tbsp mole-chicken mixture on each, fold in half, and press edges firmly to seal.

  4. 4

    Heat oil in a heavy skillet to 350°F (or until a test piece sizzles immediately). Fry empanadas 2–3 minutes per side until deep golden brown.

  5. 5

    Drain on paper towels. Toss greens with lime juice, red onion, and a pinch of salt on a serving platter.

  6. 6

    Arrange warm empanadas alongside salad. Drizzle extra mole on the plate and garnish with cilantro. Serve immediately.

Tools you’ll need

  • small skillet
  • mixing bowl
  • heavy 12-inch skillet or Dutch oven
  • instant-read thermometer (optional but recommended)
  • paper towels
  • tongs
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.