CookSnap is coming soon — Join the waitlist →

Quick Mole Negro Chicken Empanadas

Crispy pastry pockets filled with shredded chicken and rich mole negro sauce—ready in 25 minutes using jarred mole as the shortcut. Deeply flavored, messy-fingered delicious.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Quick Mole Negro Chicken Empanadas
comfortindulgentmexicanchickencrispytenderflakyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • ¾ cup jarred mole negro sauce
  • 16 pieces empanada wrappers or wonton skins
  • ½ cup Oaxaca cheese or mozzarella, shredded
  • ¼ large white onion, finely minced
  • 2 tbsp fresh epazote or cilantro, chopped
  • 3 tbsp neutral oil, for frying
  • 2 tbsp water, for sealing

Instructions

  1. 1

    Stir shredded chicken, mole sauce, cheese, onion, and cilantro in a bowl until combined.

  2. 2

    Lay a wrapper flat, spoon 1 tbsp filling into the center, wet edges with water, fold in half, then crimp with a fork.

  3. 3

    Repeat with remaining wrappers and filling. Arrange empanadas on a plate so you can grab them as they cook.

  4. 4

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  5. 5

    Fry empanadas in batches, 2-3 minutes per side, until golden brown and crispy. Don't crowd the pan.

  6. 6

    Transfer to a paper-towel-lined plate. Serve hot, ideally with extra mole for dipping or drizzling.

Tools you’ll need

  • large mixing bowl
  • large skillet (12-inch preferred)
  • fork (for crimping)
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.