CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Mackerel Sushi Press

Hot-seared mackerel pressed into seasoned sushi rice with crispy edges, topped with pickled ginger and wasabi. A 20-minute viral sushi bowl that skips the rolling.

Total time
20 min
Servings
2
Calories
480
Protein
38g
Crispy Mackerel Sushi Press
elegantfreshjapanesemackerelcrispytendercreamyweeknight

Ingredients

  • 2 fillets (about 6 oz each) mackerel fillets, skin-on
  • 1.5 cups sushi rice (or short-grain white rice, cooked)
  • 1.5 tbsp rice vinegar
  • ½ tsp granulated sugar
  • ½ sheet nori (seaweed sheets), cut into strips
  • ¼ cup pickled ginger (gari)
  • 1 tbsp wasabi
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Warm cooked rice with rice vinegar and sugar until grains just stick together but remain loose. Divide between two bowls.

  2. 2

    Pat mackerel fillets dry and season both sides generously with salt and black pepper.

  3. 3

    Heat oil in a skillet over medium-high until shimmering. Sear mackerel skin-side down 2 minutes until skin crisps and releases easily.

  4. 4

    Flip and sear flesh side 90 seconds until opaque. Transfer to a cutting board and slice into bite-sized pieces.

  5. 5

    Arrange mackerel pieces in a single layer over each rice bowl, pressing gently so they adhere to the warm rice.

  6. 6

    Top each bowl with pickled ginger, a dollop of wasabi, nori strips, and sesame seeds. Serve immediately.

Tools you’ll need

  • two serving bowls
  • 12-inch non-stick skillet
  • paper towels
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.