Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Lamb-Stuffed Eggplant

Tender eggplant rounds stuffed with spiced ground lamb and topped with crispy breadcrumbs. Ready in 20 minutes with a sheet pan and one bowl.

Total time
20 min
Servings
4
Calories
385
Protein
28g
Crispy Lamb-Stuffed Eggplant
comfortrusticsyrianlambcrispytenderweeknightmain-dish

Ingredients

  • 1 lb ground lamb
  • 1 whole eggplant, large
  • ½ medium yellow onion, minced
  • 2 tbsp pomegranate molasses
  • ½ cup panko breadcrumbs
  • ¼ cup fresh parsley, chopped

Instructions

  1. 1

    Slice eggplant into 0.5-inch rounds. Pat dry with paper towels.

  2. 2

    Brown ground lamb with onion in a large skillet over medium-high heat, breaking up with a spoon, until no pink remains, ~5 minutes.

  3. 3

    Stir pomegranate molasses and parsley into the lamb. Season with salt and pepper to taste.

  4. 4

    Arrange eggplant rounds on the skillet around the lamb. Sprinkle breadcrumbs over each round.

  5. 5

    Cover with a lid and cook over medium heat for 8 minutes until eggplant is tender and breadcrumbs begin to brown.

  6. 6

    Remove lid and serve hot, spooning lamb mixture over each eggplant round.

Tools you’ll need

  • 12-inch skillet with lid
  • cutting board
  • knife
  • paper towels
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.