CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Minute Crispy Jalebi Swirls

Golden, syrup-soaked spiral pastries made from a quick batter piped directly into hot oil, then dunked in warm saffron-orange syrup. Ready in minutes with zero fuss.

Total time
15 min
Servings
2
Calories
342
Protein
2g
15-Minute Crispy Jalebi Swirls
indulgentsimpleindianvegetariandairy-freecrispychewysnack

Ingredients

  • ¾ cup all-purpose flour
  • 1.5 cups vegetable oil for frying, divided
  • 1 cup sugar
  • ¾ cup water
  • 1 whole orange, zested + juiced
  • 6 threads saffron threads

Instructions

  1. 1

    Combine sugar, water, orange juice, saffron, and zest in a saucepan. Bring to a simmer over medium heat, stirring once, until syrup thickens slightly, ~3 minutes. Remove and let cool slightly.

  2. 2

    Whisk flour with 0.25 cup water and a pinch of salt until you have a smooth, pourable batter with the consistency of pancake batter.

  3. 3

    Heat 1.5 cups oil in a deep skillet over medium-high until a drop of batter sizzles immediately and rises, ~350°F (about 2 minutes).

  4. 4

    Transfer batter to a piping bag fitted with a small round tip. Carefully pipe 2–3 spiral swirls directly into the oil, one at a time.

  5. 5

    Fry swirls for 60–90 seconds until golden and crispy, then flip and cook another 60 seconds. Remove with a slotted spoon to a paper towel.

  6. 6

    Immediately dunk the warm jalebi into the cooled syrup, coating all sides. Lift out with a fork and place on a serving plate. Serve warm or at room temperature.

Tools you’ll need

  • medium saucepan
  • deep skillet or wok
  • piping bag with small round tip
  • slotted spoon
  • whisk
  • fork
  • paper towels
  • candy or deep-fry thermometer (optional but recommended)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Indian recipes →